IUCN threat status:

Not evaluated

Brief Summary

Read full entry

Bacillus bataviensis



Bacillus bataviensis

Sequence ID: ref|WP_007086548.1|Length: 73Number of Matches: 1

See 1 more title(s)

Related Information

Identical Proteins-Proteins identical to the subject



Range 1: 27 to 71GenPeptGraphics Next Match Previous Match

Alignment statistics for match #1

Score

Expect

Method

Identities

Positives

Gaps

31.6 bits(70) 6.7 Compositional matrix adjust. 12/45(27%) 27/45(60%) 5/45(11%)

Query 14 AQQLIGKLQLLLQQAQRDIKLLAYREIVLA-----WASAQRDIKL 53

Q+L+ + + + QRD+ +LAY ++V++ W + Q+ +K+

Sbjct 27 TQELVEEFGITPRTIQRDLNVLAYNDLVISPSRGKWTTTQKKVKM

Query line 14 from the HIV glycoprotein region (with molecular tool in selected assay via NCBI-NIH blast tool gives this result.

Unreviewed

Creative Commons Attribution 3.0 (CC BY 3.0)

© Thyenmed.com

Supplier: mark mcgary

Belongs to 0 communities

This taxon hasn't been featured in any communities yet.

Learn more about Communities

Disclaimer

EOL content is automatically assembled from many different content providers. As a result, from time to time you may find pages on EOL that are confusing.

To request an improvement, please leave a comment on the page. Thank you!